Recombinant Mouse Ccl21a Protein
Cat.No. : | Ccl21a-20M |
Product Overview : | Recombinant Mouse Ccl21a Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Exodus-2, also known as CCL21 and 6Ckine, is a chemokine that is strongly produced in the human lymph nodes and spleen. Exodus-2 signals through the chemokine receptor CCR7 to regulate thymocyte and activated T cell migration. Exodus-2 also mediates the homing of lymphocytes to the lymphatic system. Human and mouse Exodus-2 proteins share greater than 85% amino acid sequence identity. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 12 kDa (110 aa) |
AA Sequence : | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Ccl21a chemokine (C-C motif) ligand 21A (serine) [ Mus musculus (house mouse) ] |
Official Symbol | Ccl21a |
Synonyms | CCL21A; chemokine (C-C motif) ligand 21A (serine); C-C motif chemokine 21a; exodus-2; CCL21-Ser; CC chemokine 6Ckine-ser; beta chemokine exodus-2; beta-chemokine exodus-2; small inducible cytokine A21a; small-inducible cytokine A21a; thymus-derived chemotactic agent 4; ALP; SLC; plt; CKb9; Tca4; 6Ckine; Scya21; 6CKBAC2; SCYA21a; Scya21b; AW987545; MGC107632; |
Gene ID | 18829 |
mRNA Refseq | NM_011124 |
Protein Refseq | NP_035254 |
UniProt ID | P84444 |
◆ Recombinant Proteins | ||
Ccl21a-3409M | Recombinant Mouse Ccl21a protein(Met1-Gly133) | +Inquiry |
CCL21A-896M | Recombinant Mouse CCL21A Protein (Met1-Gly133) | +Inquiry |
Ccl21a-5428M | Recombinant Mouse Ccl21a Protein (Ser24-Gly133) | +Inquiry |
Ccl21a-2033M | Active Recombinant Mouse Ccl21a Protein | +Inquiry |
Ccl21a-20M | Recombinant Mouse Ccl21a Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl21a Products
Required fields are marked with *
My Review for All Ccl21a Products
Required fields are marked with *
0
Inquiry Basket