Recombinant Mouse CCL19 Protein

• Cat.No.: Ccl19-13M
• Product Overview: Recombinant Mouse CCL19 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Macrophage inflammatory protein-3 beta (MIP-3 β), also called CCL19, is a chemokine that is expressed in the thymus, lymph nodes, and activated bone marrow stromal cells. MIP-3 β signals through the G protein-coupled receptor CCR7 to regulate normal lymphocyte recirculation. MIP-3 β also functions during T cell trafficking to the thymus, and in T cell and B cell homing to the lymph nodes and secondary lymphoid organs.
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 9.2 kDa (83 aa)
• AA Sequence: GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl19
• Synonyms: CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3
• Gene ID: 24047
• mRNA Refseq: NM_011888
• Protein Refseq: NP_036018
• UniProt ID: Q548P0