Active Human CCL19

• Cat.No.: CCL19-110H
• Product Overview: It is a synthetic Protein

Specification

• Species: Human
• Tag: Non
• Description: MIP-3b is related to other b chemokines, possessing 20-30% sequence identity with other b proteins. MIP-3b has been mapped to the 9p13 chromosome. This differs from other b proteins which are mapped to chromosome 17. MIP-3b is expressed in a variety of lymphoid tissues. and is down-regulated by the anti-inflammatory cytokine IL-10. Synthetic MIP-3b is chemotactic for cultured human lymphocytes and is a unique functional ligand for CCR-7. The CCR-7 receptor has been previously referred to as the Epstein-Barr virus-induced gene 1 (EBI1). CCR-7 is a chemokine receptor which is expressed in various lymphoid tissues and activated B and T lymphocytes. EBI1 is strongly up-regulated in B cells infected with Epstein-Barr virus and T cells infected with herpesvirus 6 or 7.
• Form: Lyophilized
• Bio-activity: Activity measured by the protein's ability to chemoattract cultured human lymphocytes. ED50 for this activity is between 0.1 and 0.4 μg/ml
• AA Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR RSS
• Applications: Activity Assay
• Storage: Product should be stored at -20°C. Aliquot to avoid freeze/thaw cycles
• Reconstitution: Recommended reconstitution in sterile phosphate buffered saline which contains at least 0.1% human or bovine serum albumin to prepare a stocksolution of no less than 20 μg/ml and vortex thoroughly.

Gene Information

• Gene Name: CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ]
• Official Symbol: CCL19
• Synonyms: CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433
• Gene ID: 6363
• mRNA Refseq: NM_006274
• Protein Refseq: NP_006265
• MIM: 602227
• UniProt ID: Q99731
• Chromosome Location: 9p13
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (i) signalling events, organism-specific biosystem
• Function: CCR chemokine receptor binding; CCR10 chemokine receptor binding; CCR7 chemokine receptor binding; chemokine activity