Recombinant Mouse Calr protein, His-tagged
Cat.No. : | Calr-5333M |
Product Overview : | Recombinant Mouse Calr protein(P14211)(18-416aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 18-416aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL |
Gene Name | Calr calreticulin [ Mus musculus ] |
Official Symbol | Calr |
Synonyms | CALR; calreticulin; CRP55; ERp60; HACBP; endoplasmic reticulum resident protein 60; CRT; Calregulin; |
Gene ID | 12317 |
mRNA Refseq | NM_007591 |
Protein Refseq | NP_031617 |
◆ Recombinant Proteins | ||
CALR-8675Z | Recombinant Zebrafish CALR | +Inquiry |
CALR-3232H | Recombinant Human CALR protein, His-tagged | +Inquiry |
CALR-27212TH | Recombinant Human CALR, His-tagged | +Inquiry |
CALR-906H | Recombinant Human Calreticulin, His-tagged | +Inquiry |
CALR-438R | Recombinant Rhesus Macaque CALR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Calr Products
Required fields are marked with *
My Review for All Calr Products
Required fields are marked with *
0
Inquiry Basket