Recombinant Mouse C4b Protein, GST-Tagged

• Cat.No.: C4b-0053M
• Product Overview: Mouse C4b partial ORF (NP_033910.2, 20 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9.
• Source: Wheat Germ
• Species: Mouse
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: KPRLLLFSPSVVNLGTPLSVGVQLLDAPPGQEVKGSVFLRNPKGGSCSPKKDFKLSSGDDFVLLSLEVPLEDVRSCGLFDLRRAPHIQLVAQSPWLRNTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C4b complement component 4B (Chido blood group) [ Mus musculus ]
• Official Symbol: C4b
• Synonyms: C4B; complement component 4B (Chido blood group); complement C4-B; complement component 4 (within H-2S); complement component 4B (Childo blood group); C4; Ss
• Gene ID: 12268
• mRNA Refseq: NM_009780
• Protein Refseq: NP_033910