Recombinant Mouse C1qa protein, His-SUMO-tagged
Cat.No. : | C1qa-2608M |
Product Overview : | Recombinant Mouse C1qa protein(P98086)(23-245aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-245aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C1qa complement component 1, q subcomponent, alpha polypeptide [ Mus musculus ] |
Official Symbol | C1qa |
Synonyms | C1QA; complement component 1, q subcomponent, alpha polypeptide; complement C1q subcomponent subunit A; C1q; AI255395; |
Gene ID | 12259 |
mRNA Refseq | NM_007572 |
Protein Refseq | NP_031598 |
◆ Recombinant Proteins | ||
C1QA-2528H | Recombinant Human C1QA protein(23-245 aa), C-His-tagged | +Inquiry |
C1QA-2722Z | Recombinant Zebrafish C1QA | +Inquiry |
C1QA-1345M | Recombinant Mouse C1QA Protein (23-245 aa), His-tagged | +Inquiry |
C1qa-2608M | Recombinant Mouse C1qa protein, His-SUMO-tagged | +Inquiry |
C1QA-0112H | Recombinant Human C1QA Protein (Ala28-Ala245), His-tagged | +Inquiry |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QA-8143HCL | Recombinant Human C1QA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1qa Products
Required fields are marked with *
My Review for All C1qa Products
Required fields are marked with *
0
Inquiry Basket