Recombinant Mouse BTLA Protein
Cat.No. : | BTLA-612M |
Product Overview : | Recombinant Mouse BTLA protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 305 |
Description : | Enables signaling receptor activity. Acts upstream of or within immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation; and negative regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Orthologous to human BTLA (B and T lymphocyte associated). |
Form : | Lyophilized |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MKTVPAMLGTPRLFREFFILHLGLWSILCEKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPGRTWLLYTLLPLGALLLLLACVCLLCFLKRIQGKEKKPSDLAGRDTNLVDIPASSRTNHQALPSGTGIYDNDPWSSMQDESELTISLQSERNNQGIVYASLNHCVIGRNPRQENNMQEAPTEYASICVRS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Btla B and T lymphocyte associated [ Mus musculus (house mouse) ] |
Official Symbol | BTLA |
Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; A630002H24; MGC124217; MGC124218; |
Gene ID | 208154 |
mRNA Refseq | NM_001037719 |
Protein Refseq | NP_001032808 |
UniProt ID | Q7TSA3 |
◆ Recombinant Proteins | ||
Btla-1844R | Recombinant Rat Btla protein, His & T7-tagged | +Inquiry |
Btla-1843M | Recombinant Mouse Btla protein, His & T7-tagged | +Inquiry |
Btla-1902M | Recombinant Mouse Btla Protein, Myc/DDK-tagged | +Inquiry |
BTLA-611H | Recombinant Human BTLA Protein | +Inquiry |
BTLA-2926M | Recombinant Mouse BTLA protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *
0
Inquiry Basket