Recombinant Mouse Bicd2 protein, GST-tagged

• Cat.No.: Bicd2-435M
• Product Overview: Recombinant Mouse Bicd2 protein(Q921C5)(660-813aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: 660-813aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: AVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQTRRGRSKAASKA

Gene Information

• Gene Name: Bicd2 bicaudal D homolog 2 (Drosophila) [ Mus musculus ]
• Official Symbol: Bicd2
• Synonyms: BICD2; bicaudal D homolog 2 (Drosophila); protein bicaudal D homolog 2; bic-D 2; AA408834; mKIAA0699; 0610027D24Rik; 1110005D12Rik; KIAA0699
• Gene ID: 76895
• mRNA Refseq: NM_001039179
• Protein Refseq: NP_001034268