Recombinant Mouse Bglap protein, His-SUMO-tagged

• Cat.No.: Bglap-2589M
• Product Overview: Recombinant Mouse Bglap protein(P86546)(50-95aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 50-95aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.1 kDa
• AA Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Bglap bone gamma carboxyglutamate protein [ Mus musculus ]
• Official Symbol: Bglap
• Synonyms: BGLAP; bone gamma carboxyglutamate protein; osteocalcin; BGP; bone Gla protein; bone gamma carboxyglutamate protein 1; gamma-carboxyglutamic acid-containing protein; OC; OG1; mOC-A; Bglap1; Bglap2
• Gene ID: 12096
• mRNA Refseq: NM_001037939
• Protein Refseq: NP_001033028