Recombinant Human BGLAP protein, GST-tagged

Cat.No. : BGLAP-1474H
Product Overview : Recombinant Human BGLAP(1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-100 a.a.
Description : This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.4 kDa
AA Sequence : MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCE LNPDCDELADHIGFQEAYRRFYGPV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ]
Official Symbol BGLAP
Synonyms BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP;
Gene ID 632
mRNA Refseq NM_199173
Protein Refseq NP_954642
MIM 112260
UniProt ID P02818
Chromosome Location 1q25-q31
Pathway Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem;
Function calcium ion binding; hydroxyapatite binding; structural constituent of bone; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BGLAP Products

Required fields are marked with *

My Review for All BGLAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon