Recombinant Human BGLAP protein, GST-tagged
Cat.No. : | BGLAP-1474H |
Product Overview : | Recombinant Human BGLAP(1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-100 a.a. |
Description : | This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCE LNPDCDELADHIGFQEAYRRFYGPV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | BGLAP bone gamma-carboxyglutamate (gla) protein [ Homo sapiens ] |
Official Symbol | BGLAP |
Synonyms | BGLAP; bone gamma-carboxyglutamate (gla) protein; osteocalcin; bone Gla protein; gamma-carboxyglutamic acid-containing protein; bone gamma-carboxyglutamate (gla) protein (osteocalcin); OC; BGP; |
Gene ID | 632 |
mRNA Refseq | NM_199173 |
Protein Refseq | NP_954642 |
MIM | 112260 |
UniProt ID | P02818 |
Chromosome Location | 1q25-q31 |
Pathway | Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; |
Function | calcium ion binding; hydroxyapatite binding; structural constituent of bone; structural molecule activity; |
◆ Recombinant Proteins | ||
BGLAP-1474H | Recombinant Human BGLAP protein, GST-tagged | +Inquiry |
BGLAP-205H | Recombinant Human BGLAP Protein, GST-tagged | +Inquiry |
BGLAP-5633HFL | Recombinant Full Length Human BGLAP protein, Flag-tagged | +Inquiry |
BGLAP-613HF | Recombinant Full Length Human BGLAP Protein, GST-tagged | +Inquiry |
BGLAP-5468Z | Recombinant Zebrafish BGLAP | +Inquiry |
◆ Native Proteins | ||
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BGLAP Products
Required fields are marked with *
My Review for All BGLAP Products
Required fields are marked with *
0
Inquiry Basket