Recombinant Mouse Bdnf protein
Cat.No. : | Bdnf-736M |
Product Overview : | Recombinant Mouse Bdnf protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 163 |
Description : | The protein encoded by this gene is a member of the nerve growth factor family. It is involved in the growth, differentiation and survival of specific types of developing neurons both in the central nervous system (CNS) and the peripheral nervous system. It is also involved in regulating synaptic plasticity in the CNS. Expression of a similar gene in human is reduced in both Alzheimer's and Huntington disease patients. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. It is able to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons when immobilized at 5 - 30 µg/mL on a nitrocellulose-coated microplate. |
Molecular Mass : | Approximately 18.5 kDa, a single non-glycosylated polypeptide chain containing 163 amino acids. |
AA Sequence : | QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL |
Endotoxin : | Less than 0.1 EU/µg of rMuCDNF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Bdnf |
Official Symbol | Bdnf |
Synonyms | BDNF; brain derived neurotrophic factor; brain-derived neurotrophic factor; anorexia BDNF; |
Gene ID | 227526 |
mRNA Refseq | NM_001048139 |
Protein Refseq | NP_001041604 |
UniProt ID | Q8CC36 |
◆ Recombinant Proteins | ||
BDNF-10202H | Recombinant Human BDNF, GST-tagged | +Inquiry |
BDNF-231H | Recombinant Human Brain-derived Neurotrophic Factor, His-tagged | +Inquiry |
BDNF-549H | Recombinant Human BDNF protein, GST-tagged | +Inquiry |
BDNF-9843M | Active Recombinant Mouse BDNF protein, His-tagged | +Inquiry |
BDNF-624R | Recombinant Rat BDNF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bdnf Products
Required fields are marked with *
My Review for All Bdnf Products
Required fields are marked with *
0
Inquiry Basket