Recombinant Mouse ATP5B protein, His-SUMO & Myc-tagged
Cat.No. : | ATP5B-2567M |
Product Overview : | Recombinant Mouse ATP5B protein(P56480)(230-529aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 230-529aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.8 kDa |
AA Sequence : | YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Atp5b ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit [ Mus musculus ] |
Official Symbol | ATP5B |
Synonyms | ATP5B; ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit; ATP synthase subunit beta, mitochondrial; mitochondrial ATP synthase, H+ transporting F1 complex beta subunit; ATP synthase, H+ transporting mitochondrial F1 complex, alpha subunit; |
Gene ID | 11947 |
mRNA Refseq | NM_016774 |
Protein Refseq | NP_058054 |
◆ Recombinant Proteins | ||
ATP5B-868R | Recombinant Rat ATP5B Protein | +Inquiry |
ATP5B-859M | Recombinant Mouse ATP5B Protein, His (Fc)-Avi-tagged | +Inquiry |
Atp5b-468R | Recombinant Rat Atp5b Protein, His-tagged | +Inquiry |
ATP5B-524R | Recombinant Rat ATP5B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5B-1137H | Recombinant Human ATP5B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5B-8605HCL | Recombinant Human ATP5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5B Products
Required fields are marked with *
My Review for All ATP5B Products
Required fields are marked with *
0
Inquiry Basket