Recombinant Mouse Apoa1 protein, His-tagged
Cat.No. : | Apoa1-753M |
Product Overview : | Recombinant Mouse Apoa1 protein(Q00623)(19-264aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Species : | Mouse |
Tag : | His |
Protein length : | 19-264aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.7 kDa |
AASequence : | WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Apoa1 apolipoprotein A-I [ Mus musculus ] |
Official Symbol | Apoa1 |
Synonyms | APOA1; apolipoprotein A-I; apo-AI; apoA-I; apolipoprotein A1; Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; MGC102525; |
Gene ID | 11806 |
mRNA Refseq | NM_009692 |
Protein Refseq | NP_033822 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Apoa1 Products
Required fields are marked with *
My Review for All Apoa1 Products
Required fields are marked with *
0
Inquiry Basket