Recombinant Mouse Angptl4 protein, His-tagged
Cat.No. : | Angptl4-6343M |
Product Overview : | Recombinant Mouse Angptl4 protein(Q9Z1P8)(24-410aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-410a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS |
Gene Name | Angptl4 angiopoietin-like 4 [ Mus musculus ] |
Official Symbol | Angptl4 |
Synonyms | ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; 425O18-1; secreted protein Bk89; angiopoietin-like protein 4; fasting-induced adipose factor; fibrinogen/angiopoietin-related protein; major histocompatibility complex region NG27; hepatic fibrinogen/angiopoietin-related protein; Arp4; Bk89; Fiaf; Ng27; Pgar; Hfarp; Pgarg; Pp1158; |
Gene ID | 57875 |
mRNA Refseq | NM_020581 |
Protein Refseq | NP_065606 |
◆ Recombinant Proteins | ||
Angptl4-6343M | Recombinant Mouse Angptl4 protein, His-tagged | +Inquiry |
Angptl4-153M | Recombinant Mouse Angptl4 Protein, His-tagged | +Inquiry |
ANGPTL4-430H | Recombinant Human ANGPTL4 protein, His-tagged | +Inquiry |
ANGPTL4-2470H | Recombinant Human ANGPTL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL4-0519H | Recombinant Human ANGPTL4 Protein (His182-Tyr388), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Angptl4 Products
Required fields are marked with *
My Review for All Angptl4 Products
Required fields are marked with *
0
Inquiry Basket