Recombinant Mouse Angptl4 protein, His-tagged

• Cat.No.: Angptl4-6343M
• Product Overview: Recombinant Mouse Angptl4 protein(Q9Z1P8)(24-410aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 24-410a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 44.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Gene Information

• Gene Name: Angptl4 angiopoietin-like 4 [ Mus musculus ]
• Official Symbol: Angptl4
• Synonyms: ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; 425O18-1; secreted protein Bk89; angiopoietin-like protein 4; fasting-induced adipose factor; fibrinogen/angiopoietin-related protein; major histocompatibility complex region NG27; hepatic fibrinogen/angiopoietin-related protein; Arp4; Bk89; Fiaf; Ng27; Pgar; Hfarp; Pgarg; Pp1158
• Gene ID: 57875
• mRNA Refseq: NM_020581
• Protein Refseq: NP_065606