Recombinant Mouse AMH Protein (450-552 aa), His-tagged
Cat.No. : | AMH-1327M |
Product Overview : | Recombinant Mouse AMH Protein (450-552 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 450-552 aa |
Description : | This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.3 kDa |
AA Sequence : | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Amh anti-Mullerian hormone [ Mus musculus ] |
Official Symbol | AMH |
Synonyms | AMH; anti-Mullerian hormone; MIS; |
Gene ID | 11705 |
mRNA Refseq | NM_007445 |
Protein Refseq | NP_031471 |
UniProt ID | P27106 |
◆ Recombinant Proteins | ||
AMH-132H | Recombinant Human AMH Protein, His-tagged | +Inquiry |
AMH-131H | Recombinant Human AMH Protein, His-tagged | +Inquiry |
AMH-306R | Recombinant Rat AMH Protein, His (Fc)-Avi-tagged | +Inquiry |
AMH-35H | Recombinant Human AMH Full Length protein | +Inquiry |
AMH-1327M | Recombinant Mouse AMH Protein (450-552 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMH Products
Required fields are marked with *
My Review for All AMH Products
Required fields are marked with *
0
Inquiry Basket