Recombinant Mouse AMH Protein (450-552 aa)

Cat.No. : AMH-2173M
Product Overview : Recombinant Mouse AMH Protein (450-552 aa) is produced by E. coli expression system. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 450-552 aa
Description : This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.3 kDa
AA Sequence : DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Amh anti-Mullerian hormone [ Mus musculus ]
Official Symbol AMH
Synonyms AMH; anti-Mullerian hormone; MIS;
Gene ID 11705
mRNA Refseq NM_007445
Protein Refseq NP_031471
UniProt ID P27106

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AMH Products

Required fields are marked with *

My Review for All AMH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon