Recombinant Mouse Acy1 Protein, His-tagged

• Cat.No.: Acy1-7144M
• Product Overview: Recombinant mouse Acy1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 48.4 kDa
• Protein length: 1-408
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSEFMTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: In Phosphate buffered saline (pH7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Acy1 aminoacylase 1 [ Mus musculus (house mouse) ]
• Official Symbol: Acy1
• Synonyms: Acy1; aminoacylase 1; Acy-; Acy-1; 1110014J22Rik; aminoacylase-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14
• Gene ID: 109652
• mRNA Refseq: NM_001276442
• Protein Refseq: NP_001263371
• UniProt ID: Q99JW2