Recombinant Mouse ABHD11 Protein (1-307 aa), His-tagged

Cat.No. : ABHD11-1747M
Product Overview : Recombinant Mouse ABHD11 Protein (1-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 1-307 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.6 kDa
AA Sequence : MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Abhd11 abhydrolase domain containing 11 [ Mus musculus ]
Official Symbol ABHD11
Synonyms ABHD11; abhydrolase domain containing 11; Wbscr21; 1110054D16Rik; A630008N09Rik;
Gene ID 68758
mRNA Refseq NM_001190437
Protein Refseq NP_001177366
UniProt ID Q8K4F5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABHD11 Products

Required fields are marked with *

My Review for All ABHD11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon