Species :	Moraxella catarrhalis
Source :	E.coli
Description :	Cytochrome c class II Msp22
Form :	Liquid. In 100 mM NaH2PO4 100mM Tris 4 M Urea pH 8.0.
Molecular Mass :	~16.7kDa
AA Sequence :	NSSGTATANNPQVEDRAKLMKDWRHANEGMKAMIEDPSRFDAITFKERADFIADTNATMWVHFEGEMAQGGHAKDEIWTDPEGFQTKIEAFTSSINALALAASEAASAADVEASYGEMASQCGSCHKAYKKK
Purity :	>85%
Storage :	Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration :	1.6 mg/ml

Official Symbol	msp22
UniProt ID	D5VDC1

◆ Recombinant Proteins
CHST2-695R	Recombinant Rhesus Macaque CHST2 Protein, His (Fc)-Avi-tagged	+Inquiry
ATP2B4-973H	Recombinant Human ATP2B4 protein, GST-tagged	+Inquiry
NA-567H	Recombinant Influenza A H3N2 (A/England/42/1972) NA Protein, His-tagged	+Inquiry
ITLN1-29874TH	Recombinant Human ITLN1, FLAG-tagged	+Inquiry
UBE2L6-6402R	Recombinant Rat UBE2L6 Protein	+Inquiry
See All CHST2 Recombinant Proteins

◆ Native Proteins
BOD-38	Active Native Bilirubin oxidase	+Inquiry
IgG-148H	Native Human IgG Fab fragment	+Inquiry
VTN-384B	Native Bovine Vitronectin	+Inquiry
LH-838H	Active Native Human Luteinizing Hormone	+Inquiry
CA2-33R	Native Rat Carbonic Anhydrase II (CA2) Protein	+Inquiry
See All BOD Native Proteins

◆ Cell & Tissue Lysates
PPP1R7-2933HCL	Recombinant Human PPP1R7 293 Cell Lysate	+Inquiry
LY6D-4602HCL	Recombinant Human LY6D 293 Cell Lysate	+Inquiry
XRCC3-256HCL	Recombinant Human XRCC3 293 Cell Lysate	+Inquiry
TM2D3-1037HCL	Recombinant Human TM2D3 293 Cell Lysate	+Inquiry
WHSC1-1931HCL	Recombinant Human WHSC1 cell lysate	+Inquiry
See All PPP1R7 Cell & Tissue Lysates