Recombinant Monkeypox Virus I7L Protein, His-tagged

Cat.No. : I7L-0586M
Product Overview : Recombinant Monkeypox Virus I7L protein with a His-tag was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : MPX
Source : E.coli
Tag : His
Description : Monkeypox virus (MPXV), a DNA virus, is the aetiological agent of a zoonotic disease known as monkeypox (MPX) and is grouped into two genetic clades, namely West Africa (WA) clade and Congo Basin (CB) clade. MPX has an incubation period of 4–21 days and the symptoms range from fever to respiratory distress, which are similar to symptoms of smallpox except for lymphadenopathy.
Molecular Mass : The protein has a calculated MW of 50 kDa.
AA Sequence : MERYTDLVISKIPELGFTNLLCHIYSLAGLCSNIDVSKFLTNCNGYVVEKYDKSTTAGKVSCIPIGMMLELVESGHLSRPNSSDELDQKKELTDELTTRYHSIYDVFELPTSIPLAYFFKPQLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPERGAWMSNRSIKNLVSQFAYGSEVDYIGQFDMRFLNSLAIHEKFDAFMNKHILSYILKDKIKSSTSRFVMFGFCYLSHWKCVIYDKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRHSVLDNTNCDIDVLFRFFECTFGAKIGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLADKKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKSINVICDKLTTKLNRIVDDDEHHHHHH
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.34 mg/mL
Storage Buffer : 25mM Tris, pH6.8, 150mM NaCl, 0.1% SKL
Official Symbol I7L
Synonyms I7L

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All I7L Products

Required fields are marked with *

My Review for All I7L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon