Recombinant Monkeypox Virus I7L Protein, His-tagged
Cat.No. : | I7L-0586M |
Product Overview : | Recombinant Monkeypox Virus I7L protein with a His-tag was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | MPX |
Source : | E.coli |
Tag : | His |
Description : | Monkeypox virus (MPXV), a DNA virus, is the aetiological agent of a zoonotic disease known as monkeypox (MPX) and is grouped into two genetic clades, namely West Africa (WA) clade and Congo Basin (CB) clade. MPX has an incubation period of 4–21 days and the symptoms range from fever to respiratory distress, which are similar to symptoms of smallpox except for lymphadenopathy. |
Molecular Mass : | The protein has a calculated MW of 50 kDa. |
AA Sequence : | MERYTDLVISKIPELGFTNLLCHIYSLAGLCSNIDVSKFLTNCNGYVVEKYDKSTTAGKVSCIPIGMMLELVESGHLSRPNSSDELDQKKELTDELTTRYHSIYDVFELPTSIPLAYFFKPQLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPERGAWMSNRSIKNLVSQFAYGSEVDYIGQFDMRFLNSLAIHEKFDAFMNKHILSYILKDKIKSSTSRFVMFGFCYLSHWKCVIYDKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRHSVLDNTNCDIDVLFRFFECTFGAKIGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLADKKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKSINVICDKLTTKLNRIVDDDEHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.34 mg/mL |
Storage Buffer : | 25mM Tris, pH6.8, 150mM NaCl, 0.1% SKL |
Official Symbol | I7L |
Synonyms | I7L |
◆ Recombinant Proteins | ||
MPXV-0587 | Recombinant Monkeypox Virus I7L Protein, Core protease I7 | +Inquiry |
I7L-0586M | Recombinant Monkeypox Virus I7L Protein, His-tagged | +Inquiry |
MPXV-0782 | Recombinant Monkeypox Virus Protein, MPXVgp068 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All I7L Products
Required fields are marked with *
My Review for All I7L Products
Required fields are marked with *
0
Inquiry Basket