Recombinant Monkeypox Virus I7L Protein, His tagged

Cat.No. : MPXV-0586
Product Overview : Recombinant Monkeypox Virus I7L Protein with His-tag was expressed in E. coli.
Availability February 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : MPX
Source : E.coli
Tag : His
Molecular Mass : The protein has a calculated MW of 50 kDa.
AA Sequence : MERYTDLVISKIPELGFTNLLCHIYSLAGLCSNIDVSKFLTNCNGYVVEKYDKSTTAGKVSCIPIGMMLELVESGHLSRPNSSDELDQKKELTDELTTRYHSIYDVFELPTSIPLAYFFKPQLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPERGAWMSNRSIKNLVSQFAYGSEVDYIGQFDMRFLNSLAIHEKFDAFMNKHILSYILKDKIKSSTSRFVMFGFCYLSHWKCVIYDKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRHSVLDNTNCDIDVLFRFFECTFGAKIGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLADKKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKSINVICDKLTTKLNRIVDDDEHHHHHH
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.34 mg/mL
Storage Buffer : 25mM Tris, pH 6.8, 150mM NaCl, 0.1% SKL
Gene Name OPG083 Viral core cysteine proteinase [ Monkeypox virus ]
Official Symbol OPG083
Synonyms OPG083; Viral core cysteine proteinase; Taxonomic breadth: chordopoxvirinae; Old product: I7L; virion core protein; similar to DNA topoisomerase II; Virion core cysteine protease; similar to VACV-WR I7L and VACV-Cop I7L
Gene ID 929056
Protein Refseq NP_536495
UniProt ID A0A0F6N6K4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OPG083 Products

Required fields are marked with *

My Review for All OPG083 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon