Recombinant Monkeypox Virus I7L Protein, His tagged
Cat.No. : | MPXV-0586 |
Product Overview : | Recombinant Monkeypox Virus I7L Protein with His-tag was expressed in E. coli. |
Availability | February 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | MPX |
Source : | E.coli |
Tag : | His |
Molecular Mass : | The protein has a calculated MW of 50 kDa. |
AA Sequence : | MERYTDLVISKIPELGFTNLLCHIYSLAGLCSNIDVSKFLTNCNGYVVEKYDKSTTAGKVSCIPIGMMLELVESGHLSRPNSSDELDQKKELTDELTTRYHSIYDVFELPTSIPLAYFFKPQLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPERGAWMSNRSIKNLVSQFAYGSEVDYIGQFDMRFLNSLAIHEKFDAFMNKHILSYILKDKIKSSTSRFVMFGFCYLSHWKCVIYDKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRHSVLDNTNCDIDVLFRFFECTFGAKIGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLADKKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKSINVICDKLTTKLNRIVDDDEHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.34 mg/mL |
Storage Buffer : | 25mM Tris, pH 6.8, 150mM NaCl, 0.1% SKL |
Gene Name | OPG083 Viral core cysteine proteinase [ Monkeypox virus ] |
Official Symbol | OPG083 |
Synonyms | OPG083; Viral core cysteine proteinase; Taxonomic breadth: chordopoxvirinae; Old product: I7L; virion core protein; similar to DNA topoisomerase II; Virion core cysteine protease; similar to VACV-WR I7L and VACV-Cop I7L |
Gene ID | 929056 |
Protein Refseq | NP_536495 |
UniProt ID | A0A0F6N6K4 |
◆ Recombinant Proteins | ||
ADCK4-68R | Recombinant Rhesus Macaque ADCK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSRB3-6470HF | Recombinant Full Length Human MSRB3 Protein, GST-tagged | +Inquiry |
P2RX2-3890R | Recombinant Rat P2RX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36238SF | Recombinant Full Length Salmonella Enteritidis Pt4 Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
LINC00518-1854H | Recombinant Human LINC00518 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
Spinal Cord-010H | Human Spinal Cord Lysate, Total Protein | +Inquiry |
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLA-1811HCL | Recombinant Human SLA 293 Cell Lysate | +Inquiry |
ZDHHC7-192HCL | Recombinant Human ZDHHC7 293 Cell Lysate | +Inquiry |
OR6A2-3557HCL | Recombinant Human OR6A2 293 Cell Lysate | +Inquiry |
TUBE1-645HCL | Recombinant Human TUBE1 293 Cell Lysate | +Inquiry |
CARD9-284HCL | Recombinant Human CARD9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OPG083 Products
Required fields are marked with *
My Review for All OPG083 Products
Required fields are marked with *
0
Inquiry Basket