Recombinant Monkeypox virus A36R Protein, His-tagged

• Cat.No.: A36R-226M
• Product Overview: Recombinant Monkeypox virus A36R Protein with His tag was expressed in E. coli.

Specification

• Species: MPX
• Source: E.coli
• Tag: His
• Description: Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
• Molecular Mass: ~13 kDa
• AA Sequence: HMYREELMPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYKLE
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: 2M Urea, pH7.4

Gene Information

• Official Symbol: A36R
• Synonyms: A36R
• UniProt ID: Q5IXM9