Recombinant Methanothermobacter Marburgensis FNO Protein (1-224 aa), His-Myc-tagged

• Cat.No.: FNO-2486M
• Product Overview: Recombinant Methanothermobacter Marburgensis (strain ATCC BAA-927/DSM 2133/JCM 14651/NBRC 100331/OCM 82/Marburg) (Methanobacterium thermoautotrophicum) FNO Protein (1-224 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Methanothermobacter Marburgensis
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-224 aa
• Description: Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.4 kDa
• AA Sequence: MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: fno
• UniProt ID: D9PVP5