Recombinant Medicinal leech Hirudin protein, GST-tagged
Cat.No. : | Hirudin-4247M |
Product Overview : | Recombinant Medicinal leech Hirudin protein(P01050)(1-65aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Medicinal leech |
Source : | E.coli |
Tag : | GST |
ProteinLength : | 1-65aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34 kDa |
AA Sequence : | VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
YOBU-2423B | Recombinant Bacillus subtilis YOBU protein, His-tagged | +Inquiry |
ODF4-3719H | Recombinant Human ODF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARRB1-11H | Recombinant Human ARRB1 Protein, N-His-tagged | +Inquiry |
SCO5373-1094S | Recombinant Streptomyces coelicolor A3(2) SCO5373 protein, His-tagged | +Inquiry |
APOM-7870Z | Recombinant Zebrafish APOM | +Inquiry |
◆ Native Proteins | ||
CLU-19H | Native Human Clusterin Protein | +Inquiry |
COX1-31S | Active Native Sheep COX1 protein | +Inquiry |
Plg-5356M | Native Mouse Plg protein | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Lectin-1772E | Active Native Erythrina Cristagalli Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBIP-4443HCL | Recombinant Human MBIP 293 Cell Lysate | +Inquiry |
LTA4H-653MCL | Recombinant Mouse LTA4H cell lysate | +Inquiry |
CDKL3-329HCL | Recombinant Human CDKL3 cell lysate | +Inquiry |
CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
NSG1-213HCL | Recombinant Human NSG1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Hirudin Products
Required fields are marked with *
My Review for All Hirudin Products
Required fields are marked with *
0
Inquiry Basket