Recombinant mCherry Fluorescent Protein, His tagged

• Cat.No.: mCherry-006E
• Product Overview: Recombinant mCherry Fluorescent Protein with His tag was expressed in E. coli.

Specification

• Source: E.coli
• Tag: His
• Description: mCherry is a bright red monomeric fluorescent protein created by rounds of directed evolution of DsRed. mCherry matures rapidly, making it possible to see results very soon after transfection or activation of transcription. It is highly photostable and resistant to photobleaching.
• Molecular Mass: The protein has a calculated MW of 29 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
• Endotoxin: < 1 EU/μg
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 3.4 mg/mL
• Storage Buffer: PBS, pH 7.4, 10% Glycerol
• Publications:
  Intravenous administration of blood–brain barrier-crossing conjugates facilitate biomacromolecule transport into central nervous system (2024)

Gene Information

• Official Symbol: mCherry
• Synonyms: mCherry; mCherry Fluorescent