Recombinant MBP Protein
Cat.No. : | MBP-01 |
Product Overview : | Recombinant MBP Protein without tag was expressed in E. coli. |
Availability | March 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | Non |
AA Sequence : | MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT |
Purity : | > 90% by SDS-PAGE |
Storage : | Short Term Storage at +4 centigrade. Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 2.2 mg/mL |
Storage Buffer : | 50mM Tris-HCl, 150mM NaCl, pH 8.0 |
Official Symbol | MBP |
Synonyms | MBP |
◆ Recombinant Proteins | ||
MBP-1469H | Recombinant Human Myelin Basic Protein, GST-tagged | +Inquiry |
MBP-1100H | Recombinant Human MBP Protein, His&SUMO-tagged | +Inquiry |
MBP-4512H | Recombinant Human MBP Protein (Met1-Arg304), C-GFP tagged | +Inquiry |
MBP-66E | Recombinant E. coli MBP Protein | +Inquiry |
MBP-557H | Recombinant Human MBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4438HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4437HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBP Products
Required fields are marked with *
My Review for All MBP Products
Required fields are marked with *
0
Inquiry Basket