Recombinant Malus Domestica (Apple) Mal d 4 protein, His-tagged

• Cat.No.: Mald4-01H
• Product Overview: Recombinant Malus Domestica (Apple) Mal d 4 protein with N-terminal His6 fusion tag was expressed in E. coli.

Specification

• Species: Malus Domestica
• Source: E.coli
• Tag: His
• Protein Length: 151
• Description: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity).
• Form: Buffered aqueous solution
• Molecular Mass: 16.1 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLIEQGL
• Purity: >90% by SDS-PAGE
• Applications: ELISA
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.62 mg/ml
• Storage Buffer: Solution in 50mM Tris, 0.3 M NaCl, pH7.5

Gene Information

• Gene Name: Mal d4
• Official Symbol: Mal d4
• Synonyms: MALD4
• Gene ID: 114826514
• Protein Refseq: Q9XF42.1
• UniProt ID: Q9XF42