Recombinant M. tuberculosis Immunogenic protein MPT64 Protein, His-tagged

Cat.No. : mpt64-1286M
Product Overview : Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Immunogenic protein MPT64 Protein (24-228aa) was expressed in Yeast with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : M.tuberculosis
Source : Yeast
Tag : His
Protein Length : 24-228 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 24.4 kDa
AA Sequence : APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYEL
NITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQ
GELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Immunogenic protein MPT64
Official Symbol Immunogenic protein MPT64
Synonyms Immunogenic protein MPT64; mpt64; Antigen MPT64
UniProt ID P9WIN8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Immunogenic protein MPT64 Products

Required fields are marked with *

My Review for All Immunogenic protein MPT64 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon