Recombinant M. tuberculosis Immunogenic protein MPT64 Protein, His-tagged
Cat.No. : | mpt64-1286M |
Product Overview : | Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Immunogenic protein MPT64 Protein (24-228aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | M.tuberculosis |
Source : | Yeast |
Tag : | His |
ProteinLength : | 24-228 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYEL NITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQ GELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Immunogenic protein MPT64 |
Official Symbol | Immunogenic protein MPT64 |
Synonyms | Immunogenic protein MPT64; mpt64; Antigen MPT64 |
UniProt ID | P9WIN8 |
◆ Recombinant Proteins | ||
AFP-9461H | Recombinant Human AFP protein, His-tagged | +Inquiry |
CDH17-1060C | Recombinant Cynomolgus CDH17 protein(Met 1-Thr784), His-tagged | +Inquiry |
SLC10A7-8213M | Recombinant Mouse SLC10A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
BDNF-3372H | Recombinant Human BDNF protein, His-tagged | +Inquiry |
PLXNA1-4894H | Recombinant Human PLXNA1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
Lectin-1838S | Active Native Sambucus Nigra Lectin Protein, Biotinylated | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSBP-3544HCL | Recombinant Human OSBP 293 Cell Lysate | +Inquiry |
Testis-746R | Rabbit Testis Lysate, Total Protein | +Inquiry |
KPNA2-4891HCL | Recombinant Human KPNA2 293 Cell Lysate | +Inquiry |
SLC1A6-600HCL | Recombinant Human SLC1A6 lysate | +Inquiry |
NARFL-3968HCL | Recombinant Human NARFL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Immunogenic protein MPT64 Products
Required fields are marked with *
My Review for All Immunogenic protein MPT64 Products
Required fields are marked with *
0
Inquiry Basket