Recombinant M. tuberculosis ESAT-6-like protein EsxH Protein, His-SUMO-tagged

Cat.No. : esxH-1204M
Product Overview : Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) ESAT-6-like protein EsxH Protein (2-96aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : M.tuberculosis
Source : E.coli
Tag : His&SUMO
Protein Length : 2-96 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 26.3 kDa
AA Sequence : SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHA
MSSTHEANTMAMMARDTAEAAKWGG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name ESAT-6-like protein EsxH
Official Symbol ESAT-6-like protein EsxH
Synonyms ESAT-6-like protein EsxH; esxH; 10 kDa antigen CFP7; CFP-7;Low molecular weight protein antigen 7; Protein TB10.4; CFP7
UniProt ID P9WNK2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ESAT-6-like protein EsxH Products

Required fields are marked with *

My Review for All ESAT-6-like protein EsxH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon