Recombinant M. tuberculosis ESAT-6-like protein EsxH Protein, His-SUMO-tagged

• Cat.No.: esxH-1204M
• Product Overview: Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) ESAT-6-like protein EsxH Protein (2-96aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.

Specification

• Species: M.tuberculosis
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 2-96 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 26.3 kDa
• AA Sequence: SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHA
  MSSTHEANTMAMMARDTAEAAKWGG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: ESAT-6-like protein EsxH
• Official Symbol: ESAT-6-like protein EsxH
• Synonyms: ESAT-6-like protein EsxH; esxH; 10 kDa antigen CFP7; CFP-7;Low molecular weight protein antigen 7; Protein TB10.4; CFP7
• UniProt ID: P9WNK2