Recombinant M. smegmatis DNA protection during starvation Protein, His-SUMO-tagged
| Cat.No. : | dps-1192M |
| Product Overview : | Recombinant M. smegmatis DNA protection during starvation Protein (1-183aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | M.smegmatis |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-183 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAE RIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIA HAGELEKFQWFVRAHLESAGGQLTHEGQSTEKGAADKARRKSA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | DNA protection during starvation protein |
| Official Symbol | DNA protection during starvation protein |
| Synonyms | DNA protection during starvation protein; dps; EC:1.16.-.- |
| UniProt ID | P0C558 |
| ◆ Recombinant Proteins | ||
| dps-1192M | Recombinant M. smegmatis DNA protection during starvation Protein, His-SUMO-tagged | +Inquiry |
|
|
||
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNA protection during starvation protein Products
Required fields are marked with *
My Review for All DNA protection during starvation protein Products
Required fields are marked with *
0
Inquiry Basket
