Recombinant Lachnellula hyalina MEP Protein

• Cat.No.: MEP-31L
• Product Overview: Recombinant Lachnellula hyalina MEP Protein was expressed in E. coli.

Specification

• Species: Lachnellula hyalina
• Source: E.coli
• Description: Extracellular metalloproteinase mep
• Form: 50mM Tris, 0.3 M NaCl, 10% Glycerol, pH8.0.
• Molecular Mass: 19.9kDa
• AA Sequence: MHHHHHHENLYFQGTYNGCSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.5 mg/mL

Gene Information

• Gene Name: mep Extracellular metalloproteinase mep [ Lachnellula hyalina ]
• Official Symbol: MEP
• Gene ID: 41982318
• mRNA Refseq: XM_031147098
• Protein Refseq: XP_031007635
• UniProt ID: P81054