Recombinant Klebsiella pneumoniae KPHS_36570 Protein

• Cat.No.: KPHS_36570-164K
• Product Overview: Recombinant Klebsiella pneumoniae KPHS_36570 Protein was expressed in E.coli

Specification

• Species: Klebsiella pneumoniae
• Source: E.coli
• Description: Ferric iron-catecholate outer membrane transporter
• Form: 50mM Tris-HCl, pH 8.0, 200mM NaCl, 4M Urea.
• Molecular Mass: ～18 kDa
• AA Sequence: DVNEETLVVTASATEQNVKDAPASISVITQQDLQRKPVQNLKDVLRDVPGVQLTNEGDNRKGVSIRGLSSSYTLILVDGKRVNSRNAVFRHNDFDLNWIPVDAIERIEVVRGPMSSLYGSDALGGVVN
• Purity: >85%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.

Gene Information

• Gene Name: KPHS_36570 ferric iron-catecholate outer membrane transporter [ Klebsiella pneumoniae subsp. pneumoniae HS11286 ]
• Official Symbol: KPHS_36570
• Gene ID: 11848688
• Protein Refseq: YP_005227957
• UniProt ID: A0A0H3GQY0