Recombinant Klebsiella pneumoniae KPHS_15150 Protein
| Cat.No. : | KPHS_15150-163K |
| Product Overview : | Recombinant Klebsiella pneumoniae KPHS_15150 Protein was expressed in E.coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Klebsiella pneumoniae |
| Source : | E.coli |
| Description : | putative filamentous hemagglutinin |
| Form : | 50mMTris-HCl, pH 8.0, 200mMNaCl, 4M Urea. |
| Molecular Mass : | ～33 kDa |
| AA Sequence : | LNKGTIKSNGLLSQVATASGITNDGSIAGAYYLMLSSGDYIVNTGSLSGGQLIATANGNITNGDSGTMTGTSGLSLTSGGKIRNEEKASLLSNNQIAATAIGDFLNEGKISAKHTSLTFVGDSFKNTGNINSTGQTTIQSLKQDGSANTGEIYNLGNITGENINLQTNGTLAQSSSGRIEATNAITAHSYWLNQNGYMNAADITTDHGVVNNYGNITAKNISITTYSDITNEGQISSTGDLTLNTKNKGAIYNYSTLSAGGNMTLTATKVVNGGKSCGILGLAKCGVGTLTADKLVLNSSQKYVSDMGGKQYFKSTEVNTVK |
| Purity : | >95% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Gene Name | KPHS_15150 putative filamentous hemagglutinin [ Klebsiella pneumoniae subsp. pneumoniae HS11286 ] |
| Official Symbol | KPHS_15150 |
| Gene ID | 11846516 |
| Protein Refseq | YP_005225815 |
| UniProt ID | A0A0H3GLE2 |
| ◆ Recombinant Proteins | ||
| Ntrk1-589R | Recombinant Rat TrkA, FC Chimera | +Inquiry |
| Tmub2-6533M | Recombinant Mouse Tmub2 Protein, Myc/DDK-tagged | +Inquiry |
| SEMA7A-6486Z | Recombinant Zebrafish SEMA7A | +Inquiry |
| RFL17180PF | Recombinant Full Length Pagophilus Groenlandicus Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
| RFL21145EF | Recombinant Full Length Serine-Rich 25 Kda Antigen Protein Protein, His-Tagged | +Inquiry |
| ◆ Native Proteins | ||
| Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
| Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
| Collagen-225B | Native Bovine Type IV Collagen Protein | +Inquiry |
| IgA-252H | Native Human Immunoglobulin A | +Inquiry |
| gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRAT1-701HCL | Recombinant Human TRAT1 lysate | +Inquiry |
| CNTFR-687HCL | Recombinant Human CNTFR cell lysate | +Inquiry |
| HSF2-5366HCL | Recombinant Human HSF2 293 Cell Lysate | +Inquiry |
| MLPH-4289HCL | Recombinant Human MLPH 293 Cell Lysate | +Inquiry |
| GGT6-701HCL | Recombinant Human GGT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPHS_15150 Products
Required fields are marked with *
My Review for All KPHS_15150 Products
Required fields are marked with *
0
Inquiry Basket
