Recombinant Klebsiella Oxytoca BLA Protein (25-293 aa), His-tagged

• Cat.No.: BLA-2234K
• Product Overview: Recombinant Klebsiella Oxytoca BLA Protein (25-293 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Klebsiella Oxytoca
• Source: Yeast
• Tag: His
• ProteinLength: 25-293 aa
• Description: Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 30.5 kDa
• AA Sequence: LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: bla; Carbapenem-hydrolyzing beta-lactamase KPC-2
• UniProt ID: Q848S6