Recombinant Human ZWILCH Protein, GST-tagged

Cat.No. : ZWILCH-4211H
Product Overview : Human FLJ10036 full-length ORF ( AAH36900, 1 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ZWILCH (Zwilch Kinetochore Protein) is a Protein Coding gene. Among its related pathways are Mitotic Metaphase and Anaphase and Signaling by GPCR.
Molecular Mass : 78.21 kDa
AA Sequence : MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZWILCH Zwilch, kinetochore associated, homolog (Drosophila) [ Homo sapiens ]
Official Symbol ZWILCH
Synonyms ZWILCH; Zwilch, kinetochore associated, homolog (Drosophila); protein zwilch homolog; FLJ10036; KNTC1AP; homolog of Drosophila Zwilch; hZwilch; FLJ16343; MGC111034;
Gene ID 55055
mRNA Refseq NM_017975
Protein Refseq NP_060445
MIM 609984
UniProt ID Q9H900

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZWILCH Products

Required fields are marked with *

My Review for All ZWILCH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon