Recombinant Human ZWILCH Protein, GST-tagged

• Cat.No.: ZWILCH-4211H
• Product Overview: Human FLJ10036 full-length ORF ( AAH36900, 1 a.a. - 477 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ZWILCH (Zwilch Kinetochore Protein) is a Protein Coding gene. Among its related pathways are Mitotic Metaphase and Anaphase and Signaling by GPCR.
• Molecular Mass: 78.21 kDa
• AA Sequence: MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZWILCH Zwilch, kinetochore associated, homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: ZWILCH
• Synonyms: ZWILCH; Zwilch, kinetochore associated, homolog (Drosophila); protein zwilch homolog; FLJ10036; KNTC1AP; homolog of Drosophila Zwilch; hZwilch; FLJ16343; MGC111034
• Gene ID: 55055
• mRNA Refseq: NM_017975
• Protein Refseq: NP_060445
• MIM: 609984
• UniProt ID: Q9H900