Recombinant Human ZSCAN4 protein, His-tagged
Cat.No. : | ZSCAN4-2636H |
Product Overview : | Recombinant Human ZSCAN4 protein(98-302 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 98-302 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQEALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENITNQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGNSTCEVHQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZSCAN4 zinc finger and SCAN domain containing 4 [ Homo sapiens ] |
Official Symbol | ZSCAN4 |
Synonyms | ZSCAN4; zinc finger and SCAN domain containing 4; zinc finger protein 494 , ZNF494; zinc finger and SCAN domain-containing protein 4; FLJ35105; zinc finger protein 494; ZNF494; MGC126787; MGC126789; |
Gene ID | 201516 |
mRNA Refseq | NM_152677 |
Protein Refseq | NP_689890 |
MIM | 613419 |
UniProt ID | Q8NAM6 |
◆ Recombinant Proteins | ||
ZSCAN4-8933H | Recombinant Human ZSCAN4 protein, His-tagged | +Inquiry |
ZSCAN4-196H | Recombinant Human ZSCAN4 protein, T7/His-tagged | +Inquiry |
ZSCAN4-8932H | Recombinant Human ZSCAN4 protein, GST-tagged | +Inquiry |
ZSCAN4-2636H | Recombinant Human ZSCAN4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZSCAN4-9184HCL | Recombinant Human ZSCAN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZSCAN4 Products
Required fields are marked with *
My Review for All ZSCAN4 Products
Required fields are marked with *
0
Inquiry Basket