Recombinant Human ZSCAN22 Protein, GST-tagged

• Cat.No.: ZSCAN22-4831H
• Product Overview: Human HKR2 partial ORF ( NP_862829.1, 196 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ZSCAN22 (Zinc Finger And SCAN Domain Containing 22) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZNF286A.
• Molecular Mass: 36.63 kDa
• AA Sequence: KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZSCAN22 zinc finger and SCAN domain containing 22 [ Homo sapiens ]
• Official Symbol: ZSCAN22
• Synonyms: ZSCAN22; zinc finger and SCAN domain containing 22; GLI Kruppel family member HKR2 , HKR2, zinc finger protein 50 , ZNF50; zinc finger and SCAN domain-containing protein 22; oncogene HKR2; zinc finger protein 50; GLI-Kruppel family member HKR2; krueppel-related zinc finger protein 2; HKR2; ZNF50; MGC126679; MGC138482
• Gene ID: 342945
• mRNA Refseq: NM_181846
• Protein Refseq: NP_862829
• MIM: 165260
• UniProt ID: P10073