Recombinant Human ZPBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZPBP2-5245H
Product Overview : ZPBP2 MS Standard C13 and N15-labeled recombinant protein (NP_955353) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZPBP2 (Zona Pellucida Binding Protein 2) is a Protein Coding gene. Diseases associated with ZPBP2 include Primary Biliary Cirrhosis. An important paralog of this gene is ZPBP.
Molecular Mass : 38.5 kDa
AA Sequence : MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZPBP2 zona pellucida binding protein 2 [ Homo sapiens (human) ]
Official Symbol ZPBP2
Synonyms ZPBP2; zona pellucida binding protein 2; zona pellucida-binding protein 2; MGC41930; ZPBPL; ZPBP-like protein;
Gene ID 124626
mRNA Refseq NM_199321
Protein Refseq NP_955353
MIM 608499
UniProt ID Q6X784

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZPBP2 Products

Required fields are marked with *

My Review for All ZPBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon