Recombinant Human ZPBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZPBP2-5245H
• Product Overview: ZPBP2 MS Standard C13 and N15-labeled recombinant protein (NP_955353) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ZPBP2 (Zona Pellucida Binding Protein 2) is a Protein Coding gene. Diseases associated with ZPBP2 include Primary Biliary Cirrhosis. An important paralog of this gene is ZPBP.
• Molecular Mass: 38.5 kDa
• AA Sequence: MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZPBP2 zona pellucida binding protein 2 [ Homo sapiens (human) ]
• Official Symbol: ZPBP2
• Synonyms: ZPBP2; zona pellucida binding protein 2; zona pellucida-binding protein 2; MGC41930; ZPBPL; ZPBP-like protein
• Gene ID: 124626
• mRNA Refseq: NM_199321
• Protein Refseq: NP_955353
• MIM: 608499
• UniProt ID: Q6X784