Recombinant Human ZNF91 Protein (1-208 aa), GST-tagged
Cat.No. : | ZNF91-1188H |
Product Overview : | Recombinant Human ZNF91 Protein (1-208 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-208 aa |
Description : | Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 51.4 KD |
AA Sequence : | MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQIL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ZNF91 zinc finger protein 91 [ Homo sapiens (human) ] |
Official Symbol | ZNF91 |
Synonyms | HPF7; HTF10; |
Gene ID | 7644 |
UniProt ID | Q05481 |
◆ Recombinant Proteins | ||
ZFP91-19120M | Recombinant Mouse ZFP91 Protein | +Inquiry |
Zfp91-444M | Recombinant Mouse Zfp91 Protein, MYC/DDK-tagged | +Inquiry |
ZFP91-3532H | Recombinant Human ZFP91 protein, His-B2M-tagged | +Inquiry |
ZFP91-1101HFL | Recombinant Full Length Human ZFP91 Protein, C-Flag-tagged | +Inquiry |
ZFP91-308H | Recombinant Human ZFP91 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP91-750HCL | Recombinant Human ZFP91 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF91 Products
Required fields are marked with *
My Review for All ZNF91 Products
Required fields are marked with *
0
Inquiry Basket