Recombinant Full Length Human ZFP91 Protein, C-Flag-tagged
Cat.No. : | ZFP91-1101HFL |
Product Overview : | Recombinant Full Length Human ZFP91 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in lymphotoxin-beta receptor signaling. Alternative splicing results in multiple transcript variants. A read-through transcript variant composed of ZFP91 and the downstream CNTF gene sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A ZFP91-related pseudogene has also been identified on chromosome 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.3 kDa |
AA Sequence : | MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAIAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSR RRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVTTDKDPKEEKEEEDDSALPQE VSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDVGEEHQSPGGISEEEE EEEEEMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDE EPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGR LFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKK HDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPESLTQPSDGQG LPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVL IEDSDSAGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | ZFP91 ZFP91 zinc finger protein, atypical E3 ubiquitin ligase [ Homo sapiens (human) ] |
Official Symbol | ZFP91 |
Synonyms | PZF; DSM8; DMS-8; DSM-8; FKSG11; ZFP-91; ZNF757 |
Gene ID | 80829 |
mRNA Refseq | NM_053023.5 |
Protein Refseq | NP_444251.1 |
MIM | 619289 |
UniProt ID | Q96JP5 |
◆ Recombinant Proteins | ||
ZFP91-2386H | Recombinant Human ZFP91 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZFP91-1101HFL | Recombinant Full Length Human ZFP91 Protein, C-Flag-tagged | +Inquiry |
ZFP91-3532H | Recombinant Human ZFP91 protein, His-B2M-tagged | +Inquiry |
Zfp91-444M | Recombinant Mouse Zfp91 Protein, MYC/DDK-tagged | +Inquiry |
ZFP91-19120M | Recombinant Mouse ZFP91 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP91-750HCL | Recombinant Human ZFP91 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF91 Products
Required fields are marked with *
My Review for All ZNF91 Products
Required fields are marked with *
0
Inquiry Basket