Recombinant Human ZNF763 protein, His-tagged

• Cat.No.: ZNF763-3055H
• Product Overview: Recombinant Human ZNF763 protein(268-394 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 268-394 aa
• AA Sequence: SSSFQAHKRTHTGGKPYECKQCGKSFSWCHSFQIHERTHTGEKPCECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECRKAFTYPSSLRRHERTHSAKKPYECKQCGKALSYKFSNTPKNALWRKTL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ZNF763 zinc finger protein 763 [ Homo sapiens ]
• Official Symbol: ZNF763
• Synonyms: ZNF763; zinc finger protein 763; ZNF440L; DNA-binding protein; zinc finger protein 440 like; ZNF
• Gene ID: 284390
• mRNA Refseq: NM_001012753
• Protein Refseq: NP_001012771
• UniProt ID: Q0D2J5