Recombinant Human ZNF747 Protein, GST-tagged

• Cat.No.: ZNF747-4341H
• Product Overview: Human MGC2474 full-length ORF ( NP_076420.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ZNF747 (Zinc Finger Protein 747) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is ENSG00000261459.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47 kDa
• AA Sequence: MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZNF747 zinc finger protein 747 [ Homo sapiens ]
• Official Symbol: ZNF747
• Synonyms: ZNF747; zinc finger protein 747; KRAB domain-containing protein ZNF747; MGC2474
• Gene ID: 65988
• mRNA Refseq: NM_023931
• Protein Refseq: NP_076420
• UniProt ID: Q9BV97