Recombinant Human ZNF689 protein, GST-tagged
Cat.No. : | ZNF689-301122H |
Product Overview : | Recombinant Human ZNF689 (77-173 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu77-Leu173 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ZNF689 zinc finger protein 689 [ Homo sapiens ] |
Official Symbol | ZNF689 |
Synonyms | ZNF689; zinc finger protein 689; FLJ90415; transcription-involved protein upregulated in HCC 1; TIPUH1; DKFZp762C173; |
Gene ID | 115509 |
mRNA Refseq | NM_138447 |
Protein Refseq | NP_612456 |
UniProt ID | Q96CS4 |
◆ Recombinant Proteins | ||
ZFP689-19038M | Recombinant Mouse ZFP689 Protein | +Inquiry |
ZNF689-305H | Recombinant Human zinc finger protein 689, His-tagged | +Inquiry |
ZNF689-301122H | Recombinant Human ZNF689 protein, GST-tagged | +Inquiry |
ZNF689-10463M | Recombinant Mouse ZNF689 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF689-2076HCL | Recombinant Human ZNF689 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF689 Products
Required fields are marked with *
My Review for All ZNF689 Products
Required fields are marked with *
0
Inquiry Basket