Recombinant Human ZNF593 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZNF593-3442H
• Product Overview: ZNF593 MS Standard C13 and N15-labeled recombinant protein (NP_056955) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.2 kDa
• AA Sequence: MKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZNF593 zinc finger protein 593 [ Homo sapiens (human) ]
• Official Symbol: ZNF593
• Synonyms: ZNF593; zinc finger protein 593; ZT86; zinc finger protein T86
• Gene ID: 51042
• mRNA Refseq: NM_015871
• Protein Refseq: NP_056955
• MIM: 616698
• UniProt ID: O00488