Recombinant Human ZNF461 Protein, GST-tagged

Description :	ZNF461 (Zinc Finger Protein 461) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding and transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZFP30.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.52 kDa
AA Sequence :	ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Protein length :	121-218 a.a.

Gene Name	ZNF461 zinc finger protein 461 [ Homo sapiens ]
Official Symbol	ZNF461
Synonyms	ZNF461; zinc finger protein 461; GIOT 1; MGC33911; gonadotropin inducible transcription repressor 1; gonadotropin-inducible ovary transcription repressor 1; GIOT1; GIOT-1;
Gene ID	92283
mRNA Refseq	NM_153257
Protein Refseq	NP_694989
MIM	608640
UniProt ID	Q8TAF7