Recombinant Human ZNF385C Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZNF385C-1722H
Product Overview : ZNF385C MS Standard C13 and N15-labeled recombinant protein (NP_001013646) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZNF385C (Zinc Finger Protein 385C) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZNF385D.
Molecular Mass : 18.2 kDa
AA Sequence : MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZNF385C zinc finger protein 385C [ Homo sapiens (human) ]
Official Symbol ZNF385C
Synonyms ZNF385C; zinc finger protein 385C; zinc finger protein 385C; CTD-2132N18.2; CTD-2132N18.4
Gene ID 201181
mRNA Refseq NM_001013624
Protein Refseq NP_001013646
UniProt ID Q66K41

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF385C Products

Required fields are marked with *

My Review for All ZNF385C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon