Recombinant Human ZNF281 Protein, His-tagged

• Cat.No.: ZNF281-138H
• Product Overview: Recombinant Human ZNF281 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of gene expression; negative regulation of transcription by RNA polymerase II; and positive regulation of transcription, DNA-templated. Located in nucleoplasm.
• Form: Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH8.5.
• Molecular Mass: 27.4 kDa
• AA Sequence: MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH
• Purity: >90%
• Storage: For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower. Please avoid repeated freeze-thaw cycles.
• Concentration: 8.7mg/mL

Gene Information

• Gene Name: ZNF281 zinc finger protein 281 [ Homo sapiens (human) ]
• Official Symbol: ZNF281
• Synonyms: GZP1; ZBP99; ZBP-99; ZNP-99
• Gene ID: 23528
• mRNA Refseq: NM_001281293
• Protein Refseq: NP_001268222
• MIM: 618703
• UniProt ID: Q9Y2X9