Recombinant Human ZNF26 Protein (335-533 aa), His-SUMO-tagged

• Cat.No.: ZNF26-854H
• Product Overview: Recombinant Human ZNF26 Protein (335-533 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 335-533 aa
• Description: May be involved in transcriptional regulation.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 38.6 kDa
• AA Sequence: MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ZNF26 zinc finger protein 26 [ Homo sapiens ]
• Official Symbol: ZNF26
• Synonyms: ZNF26; FLJ20755; KOX20; zinc finger protein KOX20
• Gene ID: 7574
• mRNA Refseq: NM_001256279
• Protein Refseq: NP_001243208
• MIM: 194537
• UniProt ID: P17031