Recombinant Human ZNF212 Protein (1-495 aa), His-SUMO-tagged
Cat.No. : | ZNF212-853H |
Product Overview : | Recombinant Human ZNF212 Protein (1-495 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Description : | May be involved in transcriptional regulation. |
Source : | E. coli |
Species : | Human |
Tag : | His&SUMO |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 71.4 kDa |
Protein length : | 1-495 aa |
AA Sequence : | MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ZNF212 zinc finger protein 212 [ Homo sapiens ] |
Official Symbol | ZNF212 |
Synonyms | ZNF212; C2H2 150; ZNF182; ZNFC150; C2H2-150; MGC9707; |
Gene ID | 7988 |
mRNA Refseq | NM_012256 |
Protein Refseq | NP_036388 |
MIM | 602386 |
UniProt ID | Q9UDV6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ZNF212 Products
Required fields are marked with *
My Review for All ZNF212 Products
Required fields are marked with *
0
Inquiry Basket