Recombinant Human ZNF160 Protein (1-147 aa), His-Myc-tagged

• Cat.No.: ZNF160-2166H
• Product Overview: Recombinant Human ZNF160 Protein (1-147 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Isoform 2.

Specification

• Description: May be involved in transcriptional regulation.
• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.1 kDa
• Protein length: 1-147 aa
• AA Sequence: MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ZNF160 zinc finger protein 160 [ Homo sapiens (human) ]
• Official Symbol: ZNF160
• Synonyms: ZNF160; F11; HZF5; KR18; HKr18
• Gene ID: 90338
• mRNA Refseq: NM_001102603
• Protein Refseq: NP_001096073
• UniProt ID: Q9HCG1